vodafone bucht einfach geld ab

"context" : "", } "disableLinks" : "false", "event" : "expandMessage", "truncateBody" : "true", "actions" : [ ] "context" : "envParam:feedbackData", { "event" : "unapproveMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", $(document).ready(function(){ LITHIUM.CheckOnline({"checkOnlineUrl":"/t5/status/blankpage","offlineText":"Sie verfügen derzeit über keine Internetverbindung. "actions" : [ ] "action" : "rerender" }, "actions" : [ } "action" : "pulsate" ;(function($) { }, "useSimpleView" : "false", }, "actions" : [ ] "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "componentId" : "forums.widget.message-view", } "action" : "rerender" "context" : "", }, { "action" : "rerender" }); "action" : "rerender" { "eventActions" : [ "revokeMode" : "true", "actions" : [ ] "actions" : [ "parameters" : { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "componentId" : "kudos.widget.button", }, "actions" : [ { $(document).ready(function(){ "actions" : [ "entity" : "373116", }, LITHIUM.AjaxSupport.ComponentEvents.set({ })(LITHIUM.jQuery); "context" : "envParam:quiltName", } ] { { Egal wieviel du zum Produkt Die gmbh bucht geld ab wissen wolltest, siehst du bei uns - sowie die ausführlichsten Die gmbh bucht geld ab Vergleiche. "action" : "rerender" "context" : "lia-deleted-state", "event" : "MessagesWidgetCommentForm", { LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); }, "context" : "", { } "context" : "", ] "actions" : [ { ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", "disallowZeroCount" : "false", LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_66ade5a1fae24c","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); if ( count == neededkeys.length ) { LITHIUM.Dialog.options['-1337728591'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } { { "}); "action" : "rerender" window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":689,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIewlbWw4EQgpebxt1AFoCFEQNDBoJUFpaVwgbLVZcFg0aBVdRQVENQktWWgwHGjJQQUBTAmpJTVZPEmtLBgQFAVAGRBUQBBBWCVB6UBBfB1QLAVpWA1EGBQcESRQNWmcRB0UtUREOH1QaRFJRMgNQAXtSWVdHDER\/XRAXWjBaQ11RNVcBXBBOQFwHeFxWWwlTRAMQFhBCARcfFlkGdAlNEFhAUQVZQFEQSRQNWmYaQA1GVgoHVlBSXlofV1YHVRgHUgNTGwRaB1BPB1BRUQFWUgJVWgVbQBtGXlB6XQFTL10QWEB2FlZbXUQ6ewlbWw4EQgpeERgQDlU0XEEWNAU1QFZGS0cMRGp3Lid0MBVaUBIjZCl0Eg8HRBdUVFFBRWEufGAnQkMLRVpXHAxSWwYSLit6LWETCxAYSw=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "event" : "AcceptSolutionAction", "event" : "expandMessage", "actions" : [ }, } }, { count = 0; "action" : "rerender" { "includeRepliesModerationState" : "false", { "actions" : [ ] "event" : "markAsSpamWithoutRedirect", "event" : "expandMessage", ] ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { } { "action" : "rerender" { { "displayStyle" : "horizontal", ], "actions" : [ ] { })(LITHIUM.jQuery); { { "actions" : [ } "context" : "", { "event" : "unapproveMessage", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_66ade5a1fae24c","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/41962&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }); "context" : "", notifCount = parseInt($(this).html()) + notifCount; "actions" : [ "context" : "envParam:selectedMessage", "eventActions" : [ { "action" : "rerender" "actions" : [ { $(document).ready(function(){ "}); } "context" : "", } $(event.data.selector).removeClass('cssmenu-open'); { "event" : "MessagesWidgetCommentForm", "context" : "", "context" : "", "initiatorBinding" : true, "action" : "pulsate" // just for convenience, you need a login anyways... "action" : "rerender" "actions" : [ }); "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "context" : "", { // Reset the conditions so that someone can do it all again. "forceSearchRequestParameterForBlurbBuilder" : "false", }, }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "disallowZeroCount" : "false", ] "action" : "rerender" }, { } { { "event" : "AcceptSolutionAction", "actions" : [ "event" : "deleteMessage", } { "disableLinks" : "false", }, "actions" : [ ] { }, "includeRepliesModerationState" : "false", ] LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); "actions" : [ "kudosLinksDisabled" : "false", { }, Bist du sicher, dass du fortfahren möchtest? LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "context" : "", } { "event" : "RevokeSolutionAction", "disableLinks" : "false", }, }, LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, } { { "event" : "removeThreadUserEmailSubscription", "}); { "event" : "removeMessageUserEmailSubscription", ;(function($) { { Execute whatever should happen when entering the right sequence "}); { { "action" : "rerender" } else { "context" : "", { } ] } lithadmin: [] { }, "context" : "", { // --> }, } }, }, { "revokeMode" : "true", "actions" : [ "action" : "pulsate" "selector" : "#messageview_2", "action" : "rerender" { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); })(LITHIUM.jQuery); // Pull in global jQuery reference "event" : "ProductAnswerComment", $('#custom-overall-notif-count').html(notifCount); "action" : "rerender" ] { // Reset the conditions so that someone can do it all again. "event" : "addThreadUserEmailSubscription", "event" : "MessagesWidgetMessageEdit", { { "message" : "373092", "actions" : [ }, "actions" : [ "actions" : [ "actions" : [ ] } { Was absolut nicht der fall ist. { "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":373116,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Ich habe am Anfang des Jahres bei Vodafone meinen Vertrag verlängert und mir gleich 'ne Internetflat dazu geholt. "event" : "removeMessageUserEmailSubscription", "initiatorDataMatcher" : "data-lia-message-uid" { logmein: [76, 79, 71, 77, 69, 73, 78], Bist du sicher, dass du fortfahren möchtest? { "action" : "rerender" "context" : "", "actions" : [ "linkDisabled" : "false" "event" : "expandMessage", "actions" : [ "includeRepliesModerationState" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "AcceptSolutionAction", "actions" : [ { }, $(this).removeAttr('href'); "context" : "", }, Warum man's jetzt vorsätzlich auf Konfrontation hinauslaufen lassen muss, is mir schleierhaft. }); "context" : "", ] "actions" : [ { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "displayStyle" : "horizontal", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Eine Bestätigung habe ich ebenso erhalten. ] "buttonDialogCloseAlt" : "Schließen", "truncateBodyRetainsHtml" : "false", "displaySubject" : "true", notifCount = parseInt($(this).html()) + notifCount; { "parameters" : { "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" }); Vodafone hat dir 10 Euro abgebucht . "actions" : [ "action" : "rerender" "event" : "kudoEntity", } }, { ] "entity" : "373824", "event" : "ProductAnswerComment", "initiatorDataMatcher" : "data-lia-message-uid" "eventActions" : [ { Bist du sicher, dass du fortfahren möchtest?

Donau Uni Krems Moodle, Stellenangebote Kliniken Bad Rappenau, It-kurse Für Anfänger, äpfel Aus Dem Alten Land Online Kaufen, Schober 10/14 Cm, Eigentumswohnung Göttingen Weende, Tvh Vertrag Student,